PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT28398
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 307aa    MW: 34033.5 Da    PI: 9.6361
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT28398genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.61.4e-13128172147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
         EMT28398 128 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 172
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-17122178IPR009057Homeodomain-like
PROSITE profilePS5129415.408123177IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-6126178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-18126175IPR006447Myb domain, plants
SMARTSM007175.3E-11127175IPR001005SANT/Myb domain
PfamPF002492.5E-11128172IPR001005SANT/Myb domain
CDDcd001672.26E-8130173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSTLTYAQKH GMAVRGEVEN IAGEVVALPD EMDDDPTSWS CLPSCRAPTF RSPWSAGSEV  60
WGGARLGFAV WEGGSNGVDA WGSGSGLATP QLRHKRGRDR GRQSAASAVS GDDASKKVRK  120
PYTITKSRES WTEQEHDKFL EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ KYFLKVQKNG  180
TSEHVPPPRP KRKAAHPYPQ KASKNEPGYA LKTDPSAMLR NSGMNVAVSP WTHNSIPPVV  240
ASSFMKVMPD FAQVYSFLGS VFDPSTKGHL QKLKEMNPID VETALLLMRN LSINLTSPDF  300
EDQREYI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0089540.0BT008954.1 Triticum aestivum clone wdk1c.pk011.f12:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235824.11e-126PREDICTED: protein REVEILLE 6 isoform X2
SwissprotQ8H0W32e-93RVE6_ARATH; Protein REVEILLE 6
TrEMBLM8C2Y60.0M8C2Y6_AEGTA; Myb-like protein G
STRINGMLOC_68189.31e-132(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.24e-78MYB_related family protein